SCOP 1.61: Domain d1dqjb2: 1dqj B:114-221

Lineage for d1dqjb2 (1dqj B:114-221)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Anti-lysozyme Fab HYHEL-63, (mouse), kappa L chain [49096] (3 PDB entries)

8. Domain d1dqjb2: 1dqj B:114-221 [21395]
   Other proteins in same PDB: d1dqja1, d1dqjb1, d1dqjc_

Details for d1dqjb2

PDB Entry: 1dqj, 2 Å

PDB Description: crystal structure of the anti-lysozyme antibody hyhel-63 complexed with hen egg white lysozyme

SCOP Domain Sequences for d1dqjb2:

Sequence; same for both SEQRES and ATOM records:

>d1dqjb2 b.1.1.2 (B:114-221) Immunoglobulin (constant domains of L and H chains) {Anti-lysozyme Fab HYHEL-63, (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkki

Timeline for d1dqjb2:

• d1dqjb2 first appeared (with stable ids) in SCOP 1.55
  
• d1dqjb2 appears in SCOP 1.59
  
• d1dqjb2 appears in SCOP 1.63
  
• d1dqjb2 appears in the current release, SCOPe 2.08