Lineage for d1dqja2 (1dqj A:108-214)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221023Species Anti-lysozyme Fab HYHEL-63, (mouse), kappa L chain [49096] (3 PDB entries)
  8. 221028Domain d1dqja2: 1dqj A:108-214 [21394]
    Other proteins in same PDB: d1dqja1, d1dqjb1, d1dqjc_

Details for d1dqja2

PDB Entry: 1dqj (more details), 2 Å

PDB Description: crystal structure of the anti-lysozyme antibody hyhel-63 complexed with hen egg white lysozyme

SCOP Domain Sequences for d1dqja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqja2 b.1.1.2 (A:108-214) Immunoglobulin (constant domains of L and H chains) {Anti-lysozyme Fab HYHEL-63, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1dqja2:

Click to download the PDB-style file with coordinates for d1dqja2.
(The format of our PDB-style files is described here.)

Timeline for d1dqja2: