Lineage for d3ngbl1 (3ngb L:3-107)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295971Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)
  8. 1296398Domain d3ngbl1: 3ngb L:3-107 [213932]
    automated match to d1sy6l1
    complexed with bgc, nag, trs

Details for d3ngbl1

PDB Entry: 3ngb (more details), 2.68 Å

PDB Description: crystal structure of broadly and potently neutralizing antibody vrc01 in complex with hiv-1 gp120
PDB Compounds: (L:) Antigen binding fragment of light chain: Antibody VRC01

SCOPe Domain Sequences for d3ngbl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ngbl1 b.1.1.0 (L:3-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqspgtlslspgetaiiscrtsqygslawyqqrpgqaprlviysgstraagipdrfsg
srwgpdynltisnlesgdfgvyycqqyeffgqgtkvqvd

SCOPe Domain Coordinates for d3ngbl1:

Click to download the PDB-style file with coordinates for d3ngbl1.
(The format of our PDB-style files is described here.)

Timeline for d3ngbl1: