SCOPe 2.05: Domain d3ng0a1: 3ng0 A:3-103

Lineage for d3ng0a1 (3ng0 A:3-103)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families)
   automatically mapped to Pfam PF03951

5. Family d.15.9.0: automated matches [227156] (1 protein)
   not a true family

6. Protein automated matches [226862] (4 species)
   not a true protein

7. Species Synechocystis sp. [TaxId:1148] [226156] (1 PDB entry)

8. Domain d3ng0a1: 3ng0 A:3-103 [213924]
   Other proteins in same PDB: d3ng0a2
   automated match to d1f52a1
   complexed with anp, mn

Details for d3ng0a1

PDB Entry: 3ng0, 2.8 Å

PDB Description: Crystal Structure of Glutamine Synthetase from Synechocystis sp. PCC 6803

PDB Compounds: (A:) glutamine synthetase

SCOPe Domain Sequences for d3ng0a1:

Sequence; same for both SEQRES and ATOM records:

>d3ng0a1 d.15.9.0 (A:3-103) automated matches {Synechocystis sp. [TaxId: 1148]}
rtpqevlkwiqdenikiidlkfidtpgiwqhcsfyydqldensftegipfdgssirgwka
inesdmcmvpdpntatidpfckeptlsmicsikeprtgewy

Timeline for d3ng0a1:

• d3ng0a1 first appeared in SCOPe 2.03
  
• d3ng0a1 appears in SCOPe 2.04
  
• d3ng0a1 appears in SCOPe 2.06
  
• d3ng0a1 appears in the current release, SCOPe 2.08