![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) ![]() automatically mapped to Pfam PF03951 |
![]() | Family d.15.9.0: automated matches [227156] (1 protein) not a true family |
![]() | Protein automated matches [226862] (4 species) not a true protein |
![]() | Species Synechocystis sp. [TaxId:1148] [226156] (1 PDB entry) |
![]() | Domain d3ng0a1: 3ng0 A:3-103 [213924] Other proteins in same PDB: d3ng0a2 automated match to d1f52a1 complexed with anp, mn |
PDB Entry: 3ng0 (more details), 2.8 Å
SCOPe Domain Sequences for d3ng0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ng0a1 d.15.9.0 (A:3-103) automated matches {Synechocystis sp. [TaxId: 1148]} rtpqevlkwiqdenikiidlkfidtpgiwqhcsfyydqldensftegipfdgssirgwka inesdmcmvpdpntatidpfckeptlsmicsikeprtgewy
Timeline for d3ng0a1: