Lineage for d3nf4b1 (3nf4 B:5-232)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246106Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2246107Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2246252Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 2246253Protein automated matches [226934] (25 species)
    not a true protein
  7. 2246379Species Mycobacterium thermoresistibile [TaxId:1797] [225912] (2 PDB entries)
  8. 2246385Domain d3nf4b1: 3nf4 B:5-232 [213915]
    Other proteins in same PDB: d3nf4a2, d3nf4b2
    automated match to d1ukwa2
    complexed with fad, na

Details for d3nf4b1

PDB Entry: 3nf4 (more details), 2.35 Å

PDB Description: crystal structure of acyl-coa dehydrogenase from mycobacterium thermoresistibile bound to flavin adenine dinucleotide
PDB Compounds: (B:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d3nf4b1:

Sequence, based on SEQRES records: (download)

>d3nf4b1 e.6.1.0 (B:5-232) automated matches {Mycobacterium thermoresistibile [TaxId: 1797]}
mavdrllpsqeaaelieltreiadkvldpivdrhekdetypegvfeqlgaagllslpqpe
ewggggqpyevylqvleeiaarwasvavavsvhslsshpllvfgteeqkkrwlpgmlsge
qigayslsepqagsdaaalrcaatptdggyvingskswithggkadfytlfartgegsrg
vscflvpadqpglsfgkpeekmglhavpttsafydnaridadrrigee

Sequence, based on observed residues (ATOM records): (download)

>d3nf4b1 e.6.1.0 (B:5-232) automated matches {Mycobacterium thermoresistibile [TaxId: 1797]}
mavdrllpsqeaaelieltreiadkvldpivdrhekdetypegvfeqlgaagllslpqpe
ewggggqpyevylqvleeiaarwasvavavsvhslsshpllvfgteeqkkrwlpgmlsge
qigayslseprcaatptdggyvingskswithggkadfytlfartgsrgvscflvpadqp
glsfgkpeekmglhavpttsafydnaridadrrigee

SCOPe Domain Coordinates for d3nf4b1:

Click to download the PDB-style file with coordinates for d3nf4b1.
(The format of our PDB-style files is described here.)

Timeline for d3nf4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3nf4b2