Lineage for d3nepx2 (3nep X:164-337)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1680346Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1680347Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1680841Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 1680842Protein automated matches [226850] (24 species)
    not a true protein
  7. 1680957Species Salinibacter ruber [TaxId:309807] [225985] (1 PDB entry)
  8. 1680958Domain d3nepx2: 3nep X:164-337 [213908]
    Other proteins in same PDB: d3nepx1
    automated match to d1gv0a2

Details for d3nepx2

PDB Entry: 3nep (more details), 1.55 Å

PDB Description: 1.55A resolution structure of malate dehydrogenase from Salinibacter ruber
PDB Compounds: (X:) malate dehydrogenase

SCOPe Domain Sequences for d3nepx2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nepx2 d.162.1.0 (X:164-337) automated matches {Salinibacter ruber [TaxId: 309807]}
agvldtgrfrsfiaeeldvsvrdvqallmgghgdtmvplpryttvggipvpqliddarie
eivertkgaggeivdlmgtsawyapgaaaaemteailkdnkrilpcaaycdgeyglddlf
igvpvklgaggveevievdldadekaqlktsaghvhsnlddlqrlrdegk

SCOPe Domain Coordinates for d3nepx2:

Click to download the PDB-style file with coordinates for d3nepx2.
(The format of our PDB-style files is described here.)

Timeline for d3nepx2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3nepx1