Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (24 species) not a true protein |
Species Salinibacter ruber [TaxId:309807] [225985] (1 PDB entry) |
Domain d3nepx2: 3nep X:164-337 [213908] Other proteins in same PDB: d3nepx1 automated match to d1gv0a2 |
PDB Entry: 3nep (more details), 1.55 Å
SCOPe Domain Sequences for d3nepx2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nepx2 d.162.1.0 (X:164-337) automated matches {Salinibacter ruber [TaxId: 309807]} agvldtgrfrsfiaeeldvsvrdvqallmgghgdtmvplpryttvggipvpqliddarie eivertkgaggeivdlmgtsawyapgaaaaemteailkdnkrilpcaaycdgeyglddlf igvpvklgaggveevievdldadekaqlktsaghvhsnlddlqrlrdegk
Timeline for d3nepx2: