SCOP 1.55: Domain d1dqqa2: 1dqq A:108-214

Lineage for d1dqqa2 (1dqq A:108-214)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Anti-lysozyme Fab HYHEL-63, (mouse), kappa L chain [49096] (3 PDB entries)

8. Domain d1dqqa2: 1dqq A:108-214 [21390]
   Other proteins in same PDB: d1dqqa1, d1dqqb1, d1dqqc1, d1dqqd1

Details for d1dqqa2

PDB Entry: 1dqq, 1.8 Å

PDB Description: crystal structure of anti-lysozyme antibody hyhel-63

SCOP Domain Sequences for d1dqqa2:

Sequence; same for both SEQRES and ATOM records:

>d1dqqa2 b.1.1.2 (A:108-214) Immunoglobulin (constant domains of L and H chains) {Anti-lysozyme Fab HYHEL-63, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1dqqa2:

• d1dqqa2 appears in SCOP 1.57
  
• d1dqqa2 appears in the current release, SCOPe 2.08