SCOPe 2.08: Domain d3nela1: 3nel A:1-102

Lineage for d3nela1 (3nel A:1-102)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (52 species)
   not a true protein

7. Species Thermococcus kodakarensis [TaxId:311400] [225945] (3 PDB entries)

8. Domain d3nela1: 3nel A:1-102 [213895]
   Other proteins in same PDB: d3nela2, d3nelb2
   automated match to d1c0aa1
   protein/RNA complex; complexed with asp

Details for d3nela1

PDB Entry: 3nel, 1.95 Å

PDB Description: Aspartyl-tRNA synthetase complexed with aspartic acid

PDB Compounds: (A:) ASPARTYL-tRNA SYNTHETASE

SCOPe Domain Sequences for d3nela1:

Sequence; same for both SEQRES and ATOM records:

>d3nela1 b.40.4.0 (A:1-102) automated matches {Thermococcus kodakarensis [TaxId: 311400]}
myrthysseiteelngqkvkvagwvwevkdlggikflwirdrdgivqitapkkkvdpelf
klipklrsedvvavegvvnftpkaklgfeilpekivvlnrae

Timeline for d3nela1:

• d3nela1 first appeared in SCOPe 2.03
  
• d3nela1 appears in SCOPe 2.07