SCOP 1.55: Domain d1cl7.1: 1cl7 H:114-128,I:

Lineage for d1cl7.1 (1cl7 H:114-128,I:)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab 1696, (mouse), kappa L chain [49095] (1 PDB entry)

8. Domain d1cl7.1: 1cl7 H:114-128,I: [21389]
   Other proteins in same PDB: d1cl7h1, d1cl7l1

Details for d1cl7.1

PDB Entry: 1cl7, 3 Å

PDB Description: anti hiv1 protease fab

SCOP Domain Sequences for d1cl7.1:

Sequence; same for both SEQRES and ATOM records:

>g1cl7.1 b.1.1.2 (H:114-128,I:) Immunoglobulin (constant domains of L and H chains) {Fab 1696, (mouse), kappa L chain}
akttppsvyplapgsXsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
sssvtvpssprpsetvtcnvahpasstkvdkkivprdc

Timeline for d1cl7.1:

• d1cl7.1 appears in SCOP 1.57
  
• d1cl7.1 appears in the current release, SCOPe 2.08