Class g: Small proteins [56992] (94 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (2 families) automatically mapped to Pfam PF05191 |
Family g.41.2.0: automated matches [227167] (1 protein) not a true family |
Protein automated matches [226876] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225040] (3 PDB entries) |
Domain d3ndpb2: 3ndp B:126-161 [213888] Other proteins in same PDB: d3ndpa1, d3ndpa3, d3ndpb1, d3ndpb3 automated match to d2ak3a2 complexed with so4 |
PDB Entry: 3ndp (more details), 2.3 Å
SCOPe Domain Sequences for d3ndpb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ndpb2 g.41.2.0 (B:126-161) automated matches {Human (Homo sapiens) [TaxId: 9606]} rwihppsgrvynldfnpphvhgiddvtgeplvqqed
Timeline for d3ndpb2: