Lineage for d3ndpb2 (3ndp B:126-161)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705786Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1705802Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (2 families) (S)
    automatically mapped to Pfam PF05191
  5. 1705846Family g.41.2.0: automated matches [227167] (1 protein)
    not a true family
  6. 1705847Protein automated matches [226876] (2 species)
    not a true protein
  7. 1705848Species Human (Homo sapiens) [TaxId:9606] [225040] (3 PDB entries)
  8. 1705854Domain d3ndpb2: 3ndp B:126-161 [213888]
    Other proteins in same PDB: d3ndpa1, d3ndpb1
    automated match to d2ak3a2
    complexed with so4

Details for d3ndpb2

PDB Entry: 3ndp (more details), 2.3 Å

PDB Description: crystal structure of human ak4(l171p)
PDB Compounds: (B:) Adenylate kinase isoenzyme 4

SCOPe Domain Sequences for d3ndpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ndpb2 g.41.2.0 (B:126-161) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwihppsgrvynldfnpphvhgiddvtgeplvqqed

SCOPe Domain Coordinates for d3ndpb2:

Click to download the PDB-style file with coordinates for d3ndpb2.
(The format of our PDB-style files is described here.)

Timeline for d3ndpb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ndpb1