Lineage for d1cl7l2 (1cl7 L:108-211)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1516253Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 1516485Species Mouse (Mus musculus) [TaxId:10090] [88567] (346 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 1516796Domain d1cl7l2: 1cl7 L:108-211 [21388]
    Other proteins in same PDB: d1cl7.1, d1cl7h1, d1cl7l1
    part of Fab 1696 against HIV-1 protease

Details for d1cl7l2

PDB Entry: 1cl7 (more details), 3 Å

PDB Description: anti hiv1 protease fab
PDB Compounds: (L:) PROTEIN (IGG1 ANTIBODY 1696 (light chain))

SCOPe Domain Sequences for d1cl7l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cl7l2 b.1.1.2 (L:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d1cl7l2:

Click to download the PDB-style file with coordinates for d1cl7l2.
(The format of our PDB-style files is described here.)

Timeline for d1cl7l2: