Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (31 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [226769] (3 PDB entries) |
Domain d3nbkc_: 3nbk C: [213871] automated match to d3f3ma_ complexed with ni, pns |
PDB Entry: 3nbk (more details), 1.58 Å
SCOPe Domain Sequences for d3nbkc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nbkc_ c.26.1.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} prgshmtgavcpgsfdpvtlghvdiferaaaqfdevvvailvnpaktgmfdlderiamvk estthlpnlrvqvghglvvdfvrscgmtaivkglrtgtdfeyelqmaqmnkhiagvdtff vataprysfvssslakevamlggdvsellpepvnrrlrdrln
Timeline for d3nbkc_: