Lineage for d3nbac_ (3nba C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1359291Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1359292Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1359851Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 1359852Protein automated matches [190459] (31 species)
    not a true protein
  7. 1359953Species Mycobacterium tuberculosis [TaxId:1773] [226769] (3 PDB entries)
  8. 1359964Domain d3nbac_: 3nba C: [213863]
    automated match to d3f3ma_
    complexed with apc, mg

Details for d3nbac_

PDB Entry: 3nba (more details), 2.68 Å

PDB Description: Phosphopantetheine Adenylyltranferase from Mycobacterium tuberculosis in complex with adenosine-5'-[(alpha,beta)-methyleno]triphosphate (AMPCPP)
PDB Compounds: (C:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d3nbac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nbac_ c.26.1.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mtgavcpgsfdpvtlghvdiferaaaqfdevvvailvnpaktgmfdlderiamvkestth
lpnlrvqvghglvvdfvrscgmtaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap
rysfvssslakevamlggdvsellpepvnrrlrdrl

SCOPe Domain Coordinates for d3nbac_:

Click to download the PDB-style file with coordinates for d3nbac_.
(The format of our PDB-style files is described here.)

Timeline for d3nbac_: