SCOP 1.61: Domain d1c5da2: 1c5d A:107-213

Lineage for d1c5da2 (1c5d A:107-213)

Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (6 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
Species Fab against the main immunogenic region of the human muscle acetylcholine receptor, (rat), kappa L chain [49094] (1 PDB entry)
Domain d1c5da2: 1c5d A:107-213 [21386]
Other proteins in same PDB: d1c5da1, d1c5db1, d1c5dh1, d1c5dl1

Details for d1c5da2

PDB Entry: 1c5d (more details), 2.4 Å

PDB Description: the crystal structure of the fab fragment of a rat monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor

SCOP Domain Sequences for d1c5da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5da2 b.1.1.2 (A:107-213) Immunoglobulin (constant domains of L and H chains) {Fab against the main immunogenic region of the human muscle acetylcholine receptor, (rat), kappa L chain}
radaaptvsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqd
skdstysmsstlsltkadyeshnlytcevvhktssspvvksfnrnec

SCOP Domain Coordinates for d1c5da2:

Click to download the PDB-style file with coordinates for d1c5da2.
(The format of our PDB-style files is described here.)

Timeline for d1c5da2: