SCOP 1.65: Domain d1c5dh2: 1c5d H:118-214

Lineage for d1c5dh2 (1c5d H:118-214)

Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
Species Rat (Rattus norvegicus) [TaxId:10116] [88578] (4 PDB entries)
Domain d1c5dh2: 1c5d H:118-214 [21385]
Other proteins in same PDB: d1c5da1, d1c5da2, d1c5db1, d1c5dh1, d1c5dl1, d1c5dl2

Details for d1c5dh2

PDB Entry: 1c5d (more details), 2.4 Å

PDB Description: the crystal structure of the fab fragment of a rat monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor

SCOP Domain Sequences for d1c5dh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5dh2 b.1.1.2 (H:118-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Rat (Rattus norvegicus)}
aqttapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsg
lytltssvtsstwpsqtvtcnvahpasstkvdkkler

SCOP Domain Coordinates for d1c5dh2:

Click to download the PDB-style file with coordinates for d1c5dh2.
(The format of our PDB-style files is described here.)

Timeline for d1c5dh2: