Lineage for d1c5dh2 (1c5d H:118-214)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221367Species Fab against the main immunogenic region of the human muscle acetylcholine receptor, (rat), kappa L chain [49094] (1 PDB entry)
  8. 221370Domain d1c5dh2: 1c5d H:118-214 [21385]
    Other proteins in same PDB: d1c5da1, d1c5db1, d1c5dh1, d1c5dl1

Details for d1c5dh2

PDB Entry: 1c5d (more details), 2.4 Å

PDB Description: the crystal structure of the fab fragment of a rat monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor

SCOP Domain Sequences for d1c5dh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5dh2 b.1.1.2 (H:118-214) Immunoglobulin (constant domains of L and H chains) {Fab against the main immunogenic region of the human muscle acetylcholine receptor, (rat), kappa L chain}
aqttapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsg
lytltssvtsstwpsqtvtcnvahpasstkvdkkler

SCOP Domain Coordinates for d1c5dh2:

Click to download the PDB-style file with coordinates for d1c5dh2.
(The format of our PDB-style files is described here.)

Timeline for d1c5dh2: