SCOPe 2.05: Domain d3nacl1: 3nac L:1-107

Lineage for d3nacl1 (3nac L:1-107)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d3nacl1: 3nac L:1-107 [213846]
   Other proteins in same PDB: d3nacl2
   automated match to d1rhha1
   complexed with act, gol, zn

Details for d3nacl1

PDB Entry: 3nac, 1.8 Å

PDB Description: crystal structure of fab15 mut7

PDB Compounds: (L:) Fab15 Mut7 light chain

SCOPe Domain Sequences for d3nacl1:

Sequence; same for both SEQRES and ATOM records:

>d3nacl1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqsiglylawyqqkpgkapklliyaasslqsgvps
rfsgsgsgtdftltisslqpedfatyycqqgntlsytfgqgtkveik

Timeline for d3nacl1:

• d3nacl1 first appeared in SCOPe 2.03
  
• d3nacl1 appears in SCOPe 2.04
  
• d3nacl1 appears in SCOPe 2.06
  
• d3nacl1 appears in the current release, SCOPe 2.08