SCOPe 2.03: Domain d3nabl1: 3nab L:1-107

Lineage for d3nabl1 (3nab L:1-107)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)

8. Domain d3nabl1: 3nab L:1-107 [213844]
   Other proteins in same PDB: d3nabl2
   automated match to d1rhha1
   complexed with act, zn

Details for d3nabl1

PDB Entry: 3nab, 2.32 Å

PDB Description: crystal structure of fab15 mut6

PDB Compounds: (L:) Fab15 Mut6 light chain

SCOPe Domain Sequences for d3nabl1:

Sequence; same for both SEQRES and ATOM records:

>d3nabl1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqsiglylawyqqkpgkapklliyaasslqsgvps
rfsgsgsgtdftltisslqpedfatyycqqgntlsytfgqgtkveik

Timeline for d3nabl1:

• d3nabl1 is new in SCOPe 2.03-stable
  
• d3nabl1 appears in SCOPe 2.04
  
• d3nabl1 appears in the current release, SCOPe 2.08