SCOPe 2.05: Domain d3n9ja1: 3n9j A:2-76

Lineage for d3n9ja1 (3n9j A:2-76)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class pi GST [81358] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52864] (49 PDB entries)

8. Domain d3n9ja1: 3n9j A:2-76 [213832]
   Other proteins in same PDB: d3n9ja2, d3n9jb2
   automated match to d13gsa2
   complexed with ca, cl, eaa, mes, pt

Details for d3n9ja1

PDB Entry: 3n9j, 1.85 Å

PDB Description: Structure of human Glutathione Transferase Pi class in complex with Ethacraplatin

PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d3n9ja1:

Sequence; same for both SEQRES and ATOM records:

>d3n9ja1 c.47.1.5 (A:2-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtl

Timeline for d3n9ja1:

• d3n9ja1 first appeared in SCOPe 2.03
  
• d3n9ja1 appears in SCOPe 2.04
  
• d3n9ja1 appears in SCOPe 2.06
  
• d3n9ja1 appears in the current release, SCOPe 2.08