SCOP 1.73: Domain d1ct8b2: 1ct8 B:114-215

Lineage for d1ct8b2 (1ct8 B:114-215)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d1ct8b2: 1ct8 B:114-215 [21381]
   Other proteins in same PDB: d1ct8a1, d1ct8a2, d1ct8b1, d1ct8c1, d1ct8c2, d1ct8d1

Details for d1ct8b2

PDB Entry: 1ct8, 2.2 Å

PDB Description: catalytic antibody 7c8 complex

PDB Compounds: (B:) 7c8 fab fragment; long chain

SCOP Domain Sequences for d1ct8b2:

Sequence; same for both SEQRES and ATOM records:

>d1ct8b2 b.1.1.2 (B:114-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

Timeline for d1ct8b2:

• d1ct8b2 first appeared (with stable ids) in SCOP 1.55
  
• d1ct8b2 appears in SCOP 1.71
  
• d1ct8b2 appears in SCOP 1.75
  
• d1ct8b2 appears in the current release, SCOPe 2.08