SCOP 1.63: Domain d1ct8b2: 1ct8 B:114-215

Lineage for d1ct8b2 (1ct8 B:114-215)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Catalytic Fab 7C8, (mouse), kappa L chain [49093] (1 PDB entry)

8. Domain d1ct8b2: 1ct8 B:114-215 [21381]
   Other proteins in same PDB: d1ct8a1, d1ct8b1, d1ct8c1, d1ct8d1

Details for d1ct8b2

PDB Entry: 1ct8, 2.2 Å

PDB Description: catalytic antibody 7c8 complex

SCOP Domain Sequences for d1ct8b2:

Sequence; same for both SEQRES and ATOM records:

>d1ct8b2 b.1.1.2 (B:114-215) Immunoglobulin (constant domains of L and H chains) {Catalytic Fab 7C8, (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

Timeline for d1ct8b2:

• d1ct8b2 first appeared (with stable ids) in SCOP 1.55
  
• d1ct8b2 appears in SCOP 1.61
  
• d1ct8b2 appears in SCOP 1.65
  
• d1ct8b2 appears in the current release, SCOPe 2.08