Lineage for d1ct8a2 (1ct8 A:108-214)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159475Species Catalytic Fab 7C8, (mouse), kappa L chain [49093] (1 PDB entry)
  8. 159476Domain d1ct8a2: 1ct8 A:108-214 [21380]
    Other proteins in same PDB: d1ct8a1, d1ct8b1, d1ct8c1, d1ct8d1

Details for d1ct8a2

PDB Entry: 1ct8 (more details), 2.2 Å

PDB Description: catalytic antibody 7c8 complex

SCOP Domain Sequences for d1ct8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ct8a2 b.1.1.2 (A:108-214) Immunoglobulin (constant domains of L and H chains) {Catalytic Fab 7C8, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1ct8a2:

Click to download the PDB-style file with coordinates for d1ct8a2.
(The format of our PDB-style files is described here.)

Timeline for d1ct8a2: