SCOP 1.65: Domain d1r24d2: 1r24 D:123-217

Lineage for d1r24d2 (1r24 D:123-217)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus), gamma3 [TaxId:10090] [88577] (5 PDB entries)

8. Domain d1r24d2: 1r24 D:123-217 [21379]
   Other proteins in same PDB: d1r24a1, d1r24a2, d1r24b1, d1r24c1, d1r24c2, d1r24d1
   part of Fab R24 from murine ascites

Details for d1r24d2

PDB Entry: 1r24, 3.1 Å

PDB Description: fab from murine igg3 kappa

SCOP Domain Sequences for d1r24d2:

Sequence; same for both SEQRES and ATOM records:

>d1r24d2 b.1.1.2 (D:123-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus), gamma3}
atttapsvyplvpgcsdtsgssvtlgclvkgyfpgpvtvkwnygalssgvrtvssvlqsg
fyslsslvtvpsstwpsqtvicnvahpasktdlik

Timeline for d1r24d2:

• d1r24d2 first appeared (with stable ids) in SCOP 1.55
  
• d1r24d2 appears in SCOP 1.63
  
• d1r24d2 appears in SCOP 1.67
  
• d1r24d2 appears in the current release, SCOPe 2.08