Lineage for d1r24d2 (1r24 D:123-217)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 9095Species Fab R24, (mouse), kappa L chain [49092] (2 PDB entries)
  8. 9101Domain d1r24d2: 1r24 D:123-217 [21379]
    Other proteins in same PDB: d1r24a1, d1r24b1, d1r24c1, d1r24d1

Details for d1r24d2

PDB Entry: 1r24 (more details), 3.1 Å

PDB Description: fab from murine igg3 kappa

SCOP Domain Sequences for d1r24d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r24d2 b.1.1.2 (D:123-217) Immunoglobulin (constant domains of L and H chains) {Fab R24, (mouse), kappa L chain}
atttapsvyplvpgcsdtsgssvtlgclvkgyfpgpvtvkwnygalssgvrtvssvlqsg
fyslsslvtvpsstwpsqtvicnvahpasktdlik

SCOP Domain Coordinates for d1r24d2:

Click to download the PDB-style file with coordinates for d1r24d2.
(The format of our PDB-style files is described here.)

Timeline for d1r24d2: