SCOPe 2.03: Domain d3n44f2: 3n44 F:293-391

Lineage for d3n44f2 (3n44 F:293-391)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (22 species)
   not a true protein

7. Species Chikungunya virus [TaxId:37124] [226027] (3 PDB entries)

8. Domain d3n44f2: 3n44 F:293-391 [213719]
   Other proteins in same PDB: d3n44f1
   automated match to d2alaa1
   complexed with act, nag, os

Details for d3n44f2

PDB Entry: 3n44, 2.35 Å

PDB Description: crystal structure of the mature envelope glycoprotein complex (trypsin cleavage; osmium soak) of chikungunya virus.

PDB Compounds: (F:) e1 envelope glycoprotein

SCOPe Domain Sequences for d3n44f2:

Sequence; same for both SEQRES and ATOM records:

>d3n44f2 b.1.18.0 (F:293-391) automated matches {Chikungunya virus [TaxId: 37124]}
apsltdmscevpacthssdfggvaiikyaaskkgkcavhsmtnavtireaeievegnsql
qisfstalasaefrvqvcstqvhcaaechppkdhivnyp

Timeline for d3n44f2:

• d3n44f2 is new in SCOPe 2.03-stable
  
• d3n44f2 appears in SCOPe 2.04
  
• d3n44f2 appears in the current release, SCOPe 2.08