Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries) |
Domain d1cf8h2: 1cf8 H:114-215 [21371] Other proteins in same PDB: d1cf8h1, d1cf8l1, d1cf8l2 part of catalytic Fab HA-19A4 with a polyene cyclase activity complexed with cd, haz |
PDB Entry: 1cf8 (more details), 2.7 Å
SCOP Domain Sequences for d1cf8h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cf8h2 b.1.1.2 (H:114-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} akttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhafpallqsd lytmsssvtvpsstwpsqtvtcsvahpassttvdkklepkdc
Timeline for d1cf8h2: