Lineage for d1cf8l2 (1cf8 L:108-214)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656306Domain d1cf8l2: 1cf8 L:108-214 [21370]
    Other proteins in same PDB: d1cf8h1, d1cf8h2, d1cf8l1
    part of catalytic Fab HA-19A4 with a polyene cyclase activity
    complexed with cd, haz

Details for d1cf8l2

PDB Entry: 1cf8 (more details), 2.7 Å

PDB Description: Convergence of catalytic antibody and terpene cyclase mechanisms: polyene cyclization directed by carbocation-pi interactions
PDB Compounds: (L:) protein (catalytic antibody 19a4 (light chain))

SCOP Domain Sequences for d1cf8l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cf8l2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radvaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1cf8l2:

Click to download the PDB-style file with coordinates for d1cf8l2.
(The format of our PDB-style files is described here.)

Timeline for d1cf8l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cf8l1