Lineage for d1cf8l2 (1cf8 L:108-214)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8600Species Catalytic Fab 19A4 (mouse), kappa L chain [49090] (1 PDB entry)
  8. 8602Domain d1cf8l2: 1cf8 L:108-214 [21370]
    Other proteins in same PDB: d1cf8h1, d1cf8l1

Details for d1cf8l2

PDB Entry: 1cf8 (more details), 2.7 Å

PDB Description: Convergence of catalytic antibody and terpene cyclase mechanisms: polyene cyclization directed by carbocation-pi interactions

SCOP Domain Sequences for d1cf8l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cf8l2 b.1.1.2 (L:108-214) Immunoglobulin (constant domains of L and H chains) {Catalytic Fab 19A4 (mouse), kappa L chain}
radvaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1cf8l2:

Click to download the PDB-style file with coordinates for d1cf8l2.
(The format of our PDB-style files is described here.)

Timeline for d1cf8l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cf8l1