Lineage for d3fctc2 (3fct C:108-213)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104555Species Mature metal chelatase catalytic Fab, (human), kappa L chain [49089] (1 PDB entry)
  8. 104558Domain d3fctc2: 3fct C:108-213 [21368]
    Other proteins in same PDB: d3fcta1, d3fctb1, d3fctc1, d3fctd1

Details for d3fctc2

PDB Entry: 3fct (more details), 2.4 Å

PDB Description: mature metal chelatase catalytic antibody with hapten

SCOP Domain Sequences for d3fctc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fctc2 b.1.1.2 (C:108-213) Immunoglobulin (constant domains of L and H chains) {Mature metal chelatase catalytic Fab, (human), kappa L chain}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrne

SCOP Domain Coordinates for d3fctc2:

Click to download the PDB-style file with coordinates for d3fctc2.
(The format of our PDB-style files is described here.)

Timeline for d3fctc2: