Lineage for d3n0ga1 (3n0g A:63-265)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276656Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1276995Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 1277308Family a.102.4.0: automated matches [227201] (1 protein)
    not a true family
  6. 1277309Protein automated matches [226931] (6 species)
    not a true protein
  7. 1277323Species Populus tremula [TaxId:80863] [225927] (2 PDB entries)
  8. 1277326Domain d3n0ga1: 3n0g A:63-265 [213669]
    Other proteins in same PDB: d3n0ga2, d3n0gb2
    automated match to d1hxga1
    complexed with dst, mg

Details for d3n0ga1

PDB Entry: 3n0g (more details), 2.8 Å

PDB Description: crystal structure of isoprene synthase from grey poplar leaves (populus x canescens) in complex with three mg2+ ions and dimethylallyl-s-thiolodiphosphate
PDB Compounds: (A:) Isoprene synthase

SCOPe Domain Sequences for d3n0ga1:

Sequence, based on SEQRES records: (download)

>d3n0ga1 a.102.4.0 (A:63-265) automated matches {Populus tremula [TaxId: 80863]}
nswdydfllssdtdesievykdkakkleaevrreinnekaefltllelidnvqrlglgyr
fesdirraldrfvssggfdgvtktslhatalsfrllrqhgfevsqeafsgfkdqngnfle
nlkedtkailslyeasflalegenildearvfaishlkelseekigkelaeqvnhalelp
lhrrtqrleavwsieayrkkeda

Sequence, based on observed residues (ATOM records): (download)

>d3n0ga1 a.102.4.0 (A:63-265) automated matches {Populus tremula [TaxId: 80863]}
nswdydfllsvykdkakkleaevrreinnekaefltllelidnvqrlglgyrfesdirra
ldrfvssggfdgvtktslhatalsfrllrqhgfevsqeafsgfkdqngnflenlkedtka
ilslyeasflalegenildearvfaishlkelseekigkelaeqvnhalelplhrrtqrl
eavwsieayrkkeda

SCOPe Domain Coordinates for d3n0ga1:

Click to download the PDB-style file with coordinates for d3n0ga1.
(The format of our PDB-style files is described here.)

Timeline for d3n0ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3n0ga2