SCOPe 2.03: Domain d3fcta2: 3fct A:108-213

Lineage for d3fcta2 (3fct A:108-213)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (147 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d3fcta2: 3fct A:108-213 [21366]
   Other proteins in same PDB: d3fcta1, d3fctb1, d3fctb2, d3fctc1, d3fctd1, d3fctd2
   part of metal chelatase catalytic Fab 7G12; mature antibody
   complexed with ca, cd, mg, mmp, na

Details for d3fcta2

PDB Entry: 3fct, 2.4 Å

PDB Description: mature metal chelatase catalytic antibody with hapten

PDB Compounds: (A:) protein (metal chelatase catalytic antibody)

SCOPe Domain Sequences for d3fcta2:

Sequence; same for both SEQRES and ATOM records:

>d3fcta2 b.1.1.2 (A:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrne

Timeline for d3fcta2:

• d3fcta2 first appeared (with stable ids) in SCOP 1.55
  
• d3fcta2 appears in SCOPe 2.02
  
• d3fcta2 appears in SCOPe 2.04
  
• d3fcta2 appears in the current release, SCOPe 2.08