SCOP 1.55: Domain d3fcta2: 3fct A:108-213

Lineage for d3fcta2 (3fct A:108-213)

Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
Species Mature metal chelatase catalytic Fab, (human), kappa L chain [49089] (1 PDB entry)
Domain d3fcta2: 3fct A:108-213 [21366]
Other proteins in same PDB: d3fcta1, d3fctb1, d3fctc1, d3fctd1

Details for d3fcta2

PDB Entry: 3fct (more details), 2.4 Å

PDB Description: mature metal chelatase catalytic antibody with hapten

SCOP Domain Sequences for d3fcta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fcta2 b.1.1.2 (A:108-213) Immunoglobulin (constant domains of L and H chains) {Mature metal chelatase catalytic Fab, (human), kappa L chain}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrne

SCOP Domain Coordinates for d3fcta2:

Click to download the PDB-style file with coordinates for d3fcta2.
(The format of our PDB-style files is described here.)

Timeline for d3fcta2: