Lineage for d3mxya_ (3mxy A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1661863Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1661864Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1661865Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1662016Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species)
  7. 1662017Species Human (Homo sapiens) [TaxId:9606] [55564] (34 PDB entries)
  8. 1662063Domain d3mxya_: 3mxy A: [213623]
    automated match to d3n84b_

Details for d3mxya_

PDB Entry: 3mxy (more details), 2.3 Å

PDB Description: Structures of Grb2-SH2 Domain and AICD peptide Complexes Reveal a Conformational Switch and Their Functional Implications.
PDB Compounds: (A:) Growth factor receptor-bound protein 2

SCOPe Domain Sequences for d3mxya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mxya_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]}
gshmkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvl
rdgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdie

SCOPe Domain Coordinates for d3mxya_:

Click to download the PDB-style file with coordinates for d3mxya_.
(The format of our PDB-style files is described here.)

Timeline for d3mxya_: