SCOPe 2.05: Domain d1sm3h2: 1sm3 H:114-213

Lineage for d1sm3h2 (1sm3 H:114-213)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (415 PDB entries)
   Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form

8. Domain d1sm3h2: 1sm3 H:114-213 [21361]
   Other proteins in same PDB: d1sm3h1, d1sm3l1, d1sm3l2
   part of tumor-specific Fab SM3 against epithelial mucin Muc1
   complexed with cd, cl

Details for d1sm3h2

PDB Entry: 1sm3, 1.95 Å

PDB Description: crystal structure of the tumor specific antibody sm3 complex with its peptide epitope

PDB Compounds: (H:) sm3 antibody

SCOPe Domain Sequences for d1sm3h2:

Sequence, based on SEQRES records:

>d1sm3h2 b.1.1.2 (H:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttpptvyplapgsnaasqsmvtlgclvkgyfpepvtvtwnsgslasgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdakivpr

Sequence, based on observed residues (ATOM records):

>d1sm3h2 b.1.1.2 (H:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttpptvyplapgsmvtlgclvkgyfpepvtvtwnsgslasgvhtfpavlqsdlytlss
svtvpsstwpsetvtcnvahpasstkvdakivpr

Timeline for d1sm3h2:

• d1sm3h2 first appeared (with stable ids) in SCOP 1.55
  
• d1sm3h2 appears in SCOPe 2.04
  
• d1sm3h2 appears in SCOPe 2.06
  
• d1sm3h2 appears in the current release, SCOPe 2.08