SCOP 1.63: Domain d1sm3h2: 1sm3 H:114-213

Lineage for d1sm3h2 (1sm3 H:114-213)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Tumor-specific Fab SM3, (mouse), lambda L chain [49087] (1 PDB entry)
   against epithelial mucin Muc1

8. Domain d1sm3h2: 1sm3 H:114-213 [21361]
   Other proteins in same PDB: d1sm3h1, d1sm3l1
   complexed with cd, cl

Details for d1sm3h2

PDB Entry: 1sm3, 1.95 Å

PDB Description: crystal structure of the tumor specific antibody sm3 complex with its peptide epitope

SCOP Domain Sequences for d1sm3h2:

Sequence, based on SEQRES records:

>d1sm3h2 b.1.1.2 (H:114-213) Immunoglobulin (constant domains of L and H chains) {Tumor-specific Fab SM3, (mouse), lambda L chain}
akttpptvyplapgsnaasqsmvtlgclvkgyfpepvtvtwnsgslasgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdakivpr

Sequence, based on observed residues (ATOM records):

>d1sm3h2 b.1.1.2 (H:114-213) Immunoglobulin (constant domains of L and H chains) {Tumor-specific Fab SM3, (mouse), lambda L chain}
akttpptvyplapgsmvtlgclvkgyfpepvtvtwnsgslasgvhtfpavlqsdlytlss
svtvpsstwpsetvtcnvahpasstkvdakivpr

Timeline for d1sm3h2:

• d1sm3h2 first appeared (with stable ids) in SCOP 1.55
  
• d1sm3h2 appears in SCOP 1.61
  
• d1sm3h2 appears in SCOP 1.65
  
• d1sm3h2 appears in the current release, SCOPe 2.08