Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88571] (20 PDB entries) |
Domain d1sm3l2: 1sm3 L:108-208 [21360] Other proteins in same PDB: d1sm3h1, d1sm3h2, d1sm3l1 part of tumor-specific Fab SM3 against epithelial mucin Muc1 complexed with cd, cl |
PDB Entry: 1sm3 (more details), 1.95 Å
SCOP Domain Sequences for d1sm3l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sm3l2 b.1.1.2 (L:108-208) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus)} seksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq snnkymassyltltarawerhssyscqvtheghtvekslsr
Timeline for d1sm3l2: