SCOP 1.67: Domain d1sm3l2: 1sm3 L:108-208

Lineage for d1sm3l2 (1sm3 L:108-208)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88571] (20 PDB entries)

8. Domain d1sm3l2: 1sm3 L:108-208 [21360]
   Other proteins in same PDB: d1sm3h1, d1sm3h2, d1sm3l1
   part of tumor-specific Fab SM3 against epithelial mucin Muc1
   complexed with cd, cl

Details for d1sm3l2

PDB Entry: 1sm3, 1.95 Å

PDB Description: crystal structure of the tumor specific antibody sm3 complex with its peptide epitope

SCOP Domain Sequences for d1sm3l2:

Sequence; same for both SEQRES and ATOM records:

>d1sm3l2 b.1.1.2 (L:108-208) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus)}
seksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtvekslsr

Timeline for d1sm3l2:

• d1sm3l2 first appeared (with stable ids) in SCOP 1.55
  
• d1sm3l2 appears in SCOP 1.65
  
• d1sm3l2 appears in SCOP 1.69
  
• d1sm3l2 appears in the current release, SCOPe 2.08