Lineage for d1sm3l2 (1sm3 L:108-208)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 54144Species Tumor-specific Fab SM3, (mouse), lambda L chain [49087] (1 PDB entry)
  8. 54146Domain d1sm3l2: 1sm3 L:108-208 [21360]
    Other proteins in same PDB: d1sm3h1, d1sm3l1

Details for d1sm3l2

PDB Entry: 1sm3 (more details), 1.95 Å

PDB Description: crystal structure of the tumor specific antibody sm3 complex with its peptide epitope

SCOP Domain Sequences for d1sm3l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sm3l2 b.1.1.2 (L:108-208) Immunoglobulin (constant domains of L and H chains) {Tumor-specific Fab SM3, (mouse), lambda L chain}
seksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtvekslsr

SCOP Domain Coordinates for d1sm3l2:

Click to download the PDB-style file with coordinates for d1sm3l2.
(The format of our PDB-style files is described here.)

Timeline for d1sm3l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sm3l1