SCOP 1.61: Domain d1sbsh2: 1sbs H:124-222

Lineage for d1sbsh2 (1sbs H:124-222)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Anti-HCG Fab 3A2, (mouse), kappa L chain [49086] (1 PDB entry)

8. Domain d1sbsh2: 1sbs H:124-222 [21359]
   Other proteins in same PDB: d1sbsh1, d1sbsl1

Details for d1sbsh2

PDB Entry: 1sbs, 2 Å

PDB Description: crystal structure of an anti-hcg fab

SCOP Domain Sequences for d1sbsh2:

Sequence; same for both SEQRES and ATOM records:

>d1sbsh2 b.1.1.2 (H:124-222) Immunoglobulin (constant domains of L and H chains) {Anti-HCG Fab 3A2, (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivp

Timeline for d1sbsh2:

• d1sbsh2 first appeared (with stable ids) in SCOP 1.55
  
• d1sbsh2 appears in SCOP 1.59
  
• d1sbsh2 appears in SCOP 1.63
  
• d1sbsh2 appears in the current release, SCOPe 2.08