SCOPe 2.04: Domain d3muge2: 3mug E:108-212

Lineage for d3muge2 (3mug E:108-212)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)

8. Domain d3muge2: 3mug E:108-212 [213581]
   Other proteins in same PDB: d3muga1, d3mugc1, d3muge1, d3mugg1, d3mugi1, d3mugk1
   automated match to d1aqkl2
   complexed with nag

Details for d3muge2

PDB Entry: 3mug, 2.49 Å

PDB Description: crystal structure of human fab pg16, a broadly reactive and potent hiv-1 neutralizing antibody

PDB Compounds: (E:) Antibody PG16 Light Chain

SCOPe Domain Sequences for d3muge2:

Sequence; same for both SEQRES and ATOM records:

>d3muge2 b.1.1.2 (E:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvapt

Timeline for d3muge2:

• d3muge2 first appeared in SCOPe 2.03
  
• d3muge2 appears in SCOPe 2.05
  
• d3muge2 appears in the current release, SCOPe 2.08