Lineage for d3muga1 (3mug A:2-107)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2368282Domain d3muga1: 3mug A:2-107 [213576]
    Other proteins in same PDB: d3muga2, d3mugc2, d3muge2, d3mugg2, d3mugi2, d3mugk2
    automated match to d1aqkl1
    complexed with nag

Details for d3muga1

PDB Entry: 3mug (more details), 2.49 Å

PDB Description: crystal structure of human fab pg16, a broadly reactive and potent hiv-1 neutralizing antibody
PDB Compounds: (A:) Antibody PG16 Light Chain

SCOPe Domain Sequences for d3muga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3muga1 b.1.1.0 (A:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
saltqpasvsgspgqtitiscngtssdvggfdsvswyqqspgkapkvmvfdvshrpsgis
nrfsgsksgntasltisglhiedegdyfcssltdrshrifgggtkvtvlg

SCOPe Domain Coordinates for d3muga1:

Click to download the PDB-style file with coordinates for d3muga1.
(The format of our PDB-style files is described here.)

Timeline for d3muga1: