Lineage for d1qbmh2 (1qbm H:113-219)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159258Species Anti-cytochrome c Fab E8, (mouse), kappa L chain [49085] (3 PDB entries)
  8. 159263Domain d1qbmh2: 1qbm H:113-219 [21357]
    Other proteins in same PDB: d1qbmh1, d1qbml1

Details for d1qbmh2

PDB Entry: 1qbm (more details), 2.37 Å

PDB Description: fab e8b antibody, x-ray structure at 2.37 angstroms resolution

SCOP Domain Sequences for d1qbmh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qbmh2 b.1.1.2 (H:113-219) Immunoglobulin (constant domains of L and H chains) {Anti-cytochrome c Fab E8, (mouse), kappa L chain}
ltvssaettppsvyplapgtaalkssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpa
vlqsdlytlsssvtvpsstwpsqtvtcnvahpasstkvdkkivprnc

SCOP Domain Coordinates for d1qbmh2:

Click to download the PDB-style file with coordinates for d1qbmh2.
(The format of our PDB-style files is described here.)

Timeline for d1qbmh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qbmh1