Lineage for d1qbll2 (1qbl L:108-214)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 103675Species Anti-cytochrome c Fab E8, (mouse), kappa L chain [49085] (3 PDB entries)
  8. 103679Domain d1qbll2: 1qbl L:108-214 [21354]
    Other proteins in same PDB: d1qblh1, d1qbll1

Details for d1qbll2

PDB Entry: 1qbl (more details), 2.26 Å

PDB Description: fab e8 (fabe8a) x-ray structure at 2.26 angstrom resolution

SCOP Domain Sequences for d1qbll2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qbll2 b.1.1.2 (L:108-214) Immunoglobulin (constant domains of L and H chains) {Anti-cytochrome c Fab E8, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1qbll2:

Click to download the PDB-style file with coordinates for d1qbll2.
(The format of our PDB-style files is described here.)

Timeline for d1qbll2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qbll1