Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) automatically mapped to Pfam PF01948 |
Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein) |
Protein Aspartate carbamoyltransferase [54895] (3 species) |
Species Escherichia coli [TaxId:562] [54896] (63 PDB entries) Uniprot P00478 |
Domain d3mpub1: 3mpu B:11-100 [213533] Other proteins in same PDB: d3mpua1, d3mpua2, d3mpub2, d3mpuc1, d3mpuc2, d3mpud2, d3mpue1, d3mpue2, d3mpuf2 automated match to d1d09b1 complexed with po4, zn |
PDB Entry: 3mpu (more details), 2.85 Å
SCOPe Domain Sequences for d3mpub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mpub1 d.58.2.1 (B:11-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]} aikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientflsedq vdqlalyapqatvnridnyevvgksrpslp
Timeline for d3mpub1: