Lineage for d1wejh2 (1wej H:113-223)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549023Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 549177Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)
  8. 549211Domain d1wejh2: 1wej H:113-223 [21353]
    Other proteins in same PDB: d1wejf_, d1wejh1, d1wejl1, d1wejl2
    part of anti-cytochrome c Fab E8
    complexed with ace, hem, zn

Details for d1wejh2

PDB Entry: 1wej (more details), 1.8 Å

PDB Description: igg1 fab fragment (of e8 antibody) complexed with horse cytochrome c at 1.8 a resolution

SCOP Domain Sequences for d1wejh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wejh2 b.1.1.2 (H:113-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
ltvssaettppsvyplapgtaalkssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpa
vlqsdlytltssvtvpsstwpsqtvtcnvahpasstkvdkkivprncggdc

SCOP Domain Coordinates for d1wejh2:

Click to download the PDB-style file with coordinates for d1wejh2.
(The format of our PDB-style files is described here.)

Timeline for d1wejh2: