Lineage for d3mpja2 (3mpj A:232-389)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487717Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1488075Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 1488205Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 1488206Protein automated matches [226935] (18 species)
    not a true protein
  7. 1488256Species Desulfococcus multivorans [TaxId:897] [225944] (2 PDB entries)
  8. 1488261Domain d3mpja2: 3mpj A:232-389 [213520]
    Other proteins in same PDB: d3mpja1, d3mpjb1, d3mpjd1, d3mpje1, d3mpjf1, d3mpjg1
    automated match to d3mdea1
    complexed with cl, fad

Details for d3mpja2

PDB Entry: 3mpj (more details), 2.1 Å

PDB Description: Structure of the glutaryl-coenzyme A dehydrogenase
PDB Compounds: (A:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d3mpja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mpja2 a.29.3.0 (A:232-389) automated matches {Desulfococcus multivorans [TaxId: 897]}
gdgarivfgslnhtrlsaaaggvglaqacldaaikycnerrqfgkpigdfqmnqdmiaqm
aveveaarllaykaaaakdegrlnngldvamakyaageavskcanyamrilgaygystey
pvarfyrdaptyymvegsanickmiialdqlgvrkanr

SCOPe Domain Coordinates for d3mpja2:

Click to download the PDB-style file with coordinates for d3mpja2.
(The format of our PDB-style files is described here.)

Timeline for d3mpja2: