SCOP 1.59: Domain d1wejl2: 1wej L:108-214

Lineage for d1wejl2 (1wej L:108-214)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)

7. Species Anti-cytochrome c Fab E8, (mouse), kappa L chain [49085] (3 PDB entries)

8. Domain d1wejl2: 1wej L:108-214 [21352]
   Other proteins in same PDB: d1wejf_, d1wejh1, d1wejl1

Details for d1wejl2

PDB Entry: 1wej, 1.8 Å

PDB Description: igg1 fab fragment (of e8 antibody) complexed with horse cytochrome c at 1.8 a resolution

SCOP Domain Sequences for d1wejl2:

Sequence; same for both SEQRES and ATOM records:

>d1wejl2 b.1.1.2 (L:108-214) Immunoglobulin (constant domains of L and H chains) {Anti-cytochrome c Fab E8, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1wejl2:

• d1wejl2 first appeared (with stable ids) in SCOP 1.55
  
• d1wejl2 appears in SCOP 1.57
  
• d1wejl2 appears in SCOP 1.61
  
• d1wejl2 appears in the current release, SCOPe 2.08