Lineage for d1wejl2 (1wej L:108-214)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53280Species Anti-cytochrome c Fab E8, (mouse), kappa L chain [49085] (3 PDB entries)
  8. 53282Domain d1wejl2: 1wej L:108-214 [21352]
    Other proteins in same PDB: d1wejf_, d1wejh1, d1wejl1

Details for d1wejl2

PDB Entry: 1wej (more details), 1.8 Å

PDB Description: igg1 fab fragment (of e8 antibody) complexed with horse cytochrome c at 1.8 a resolution

SCOP Domain Sequences for d1wejl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wejl2 b.1.1.2 (L:108-214) Immunoglobulin (constant domains of L and H chains) {Anti-cytochrome c Fab E8, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1wejl2:

Click to download the PDB-style file with coordinates for d1wejl2.
(The format of our PDB-style files is described here.)

Timeline for d1wejl2: