Lineage for d3mpid1 (3mpi D:1-231)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2570412Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2570413Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2570558Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 2570559Protein automated matches [226934] (28 species)
    not a true protein
  7. 2570642Species Desulfococcus multivorans [TaxId:897] [225943] (2 PDB entries)
  8. 2570646Domain d3mpid1: 3mpi D:1-231 [213517]
    Other proteins in same PDB: d3mpia2, d3mpia3, d3mpib2, d3mpib3, d3mpic2, d3mpic3, d3mpid2, d3mpid3
    automated match to d3mdea2
    complexed with fad, gra

Details for d3mpid1

PDB Entry: 3mpi (more details), 2.05 Å

PDB Description: Structure of the glutaryl-coenzyme A dehydrogenase glutaryl-CoA complex
PDB Compounds: (D:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d3mpid1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mpid1 e.6.1.0 (D:1-231) automated matches {Desulfococcus multivorans [TaxId: 897]}
mdfnlskelqmlqkevrnfvnkkivpfadqwdnenhfpyeeavrpmgelgffgtvipeey
ggegmdqgwlaamivteeiargssalrvqlnmevlgcaytiltygsealkkkyvpklssa
eflggfgitepdagsdvmamsstaedkgdhwllngsktwisnaaqadvliyyaytdkaag
srglsafvieprnfpgiktsnleklgshasptgelfldnvkvpkenilgkp

SCOPe Domain Coordinates for d3mpid1:

Click to download the PDB-style file with coordinates for d3mpid1.
(The format of our PDB-style files is described here.)

Timeline for d3mpid1: