SCOPe 2.04: Domain d3mpic2: 3mpi C:232-395

Lineage for d3mpic2 (3mpi C:232-395)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (18 species)
   not a true protein

7. Species Desulfococcus multivorans [TaxId:897] [225944] (2 PDB entries)

8. Domain d3mpic2: 3mpi C:232-395 [213516]
   Other proteins in same PDB: d3mpia1, d3mpib1, d3mpic1, d3mpid1
   automated match to d3mdea1
   complexed with fad, gra

Details for d3mpic2

PDB Entry: 3mpi, 2.05 Å

PDB Description: Structure of the glutaryl-coenzyme A dehydrogenase glutaryl-CoA complex

PDB Compounds: (C:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d3mpic2:

Sequence; same for both SEQRES and ATOM records:

>d3mpic2 a.29.3.0 (C:232-395) automated matches {Desulfococcus multivorans [TaxId: 897]}
gdgarivfgslnhtrlsaaaggvglaqacldaaikycnerrqfgkpigdfqmnqdmiaqm
aveveaarllaykaaaakdegrlnngldvamakyaageavskcanyamrilgaygystey
pvarfyrdaptyymvegsanickmiialdqlgvrkanrkghhhh

Timeline for d3mpic2:

• d3mpic2 first appeared in SCOPe 2.03
  
• d3mpic2 appears in SCOPe 2.05
  
• d3mpic2 appears in the current release, SCOPe 2.08